Class a: All alpha proteins [46456] (289 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) consists of single alpha-helix and irregular N-terminal tail automatically mapped to Pfam PF02315 |
Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins) |
Protein automated matches [190583] (3 species) not a true protein |
Species Hyphomicrobium denitrificans [TaxId:53399] [187590] (1 PDB entry) |
Domain d2d0vb_: 2d0v B: [163538] Other proteins in same PDB: d2d0va_, d2d0vd_, d2d0vi_ automated match to d1h4ib_ complexed with ca, pqq |
PDB Entry: 2d0v (more details), 2.49 Å
SCOPe Domain Sequences for d2d0vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d0vb_ a.137.2.1 (B:) automated matches {Hyphomicrobium denitrificans [TaxId: 53399]} ydgthckapgncwepkpgfpekiagskydpkhdpkelnkqvesrkgeeernanraehfkk tgkwvydvkk
Timeline for d2d0vb_: