Lineage for d2d0vb_ (2d0v B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) (S)
    consists of single alpha-helix and irregular N-terminal tail
    automatically mapped to Pfam PF02315
  5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)
  6. Protein automated matches [190583] (3 species)
    not a true protein
  7. Species Hyphomicrobium denitrificans [TaxId:53399] [187590] (1 PDB entry)
  8. Domain d2d0vb_: 2d0v B: [163538]
    Other proteins in same PDB: d2d0va_, d2d0vd_, d2d0vi_
    automated match to d1h4ib_
    complexed with ca, pqq

Details for d2d0vb_

PDB Entry: 2d0v (more details), 2.49 Å

PDB Description: Crystal structure of methanol dehydrogenase from Hyphomicrobium denitrificans
PDB Compounds: (B:) methanol dehydrogenase small subunit

SCOPe Domain Sequences for d2d0vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0vb_ a.137.2.1 (B:) automated matches {Hyphomicrobium denitrificans [TaxId: 53399]}
ydgthckapgncwepkpgfpekiagskydpkhdpkelnkqvesrkgeeernanraehfkk
tgkwvydvkk

SCOPe Domain Coordinates for d2d0vb_ are not available.

Timeline for d2d0vb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2d0va_, d2d0vd_, d2d0ve_, d2d0vi_, d2d0vj_