Lineage for d2d0sa_ (2d0s A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257168Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1257169Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1257759Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1257760Protein automated matches [190453] (16 species)
    not a true protein
  7. 1257798Species Hydrogenophilus thermoluteolus [TaxId:297] [187588] (1 PDB entry)
  8. 1257799Domain d2d0sa_: 2d0s A: [163536]
    automated match to d1dvva_
    complexed with hec

Details for d2d0sa_

PDB Entry: 2d0s (more details), 2.2 Å

PDB Description: Crystal structure of the Cytochrome C552 from moderate thermophilic bacterium, hydrogenophilus thermoluteolus
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d2d0sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0sa_ a.3.1.0 (A:) automated matches {Hydrogenophilus thermoluteolus [TaxId: 297]}
dealakakgcmachaidkklvgpsykdvakkyteadvpklvekvkkggagvwgpvpmpph
pqvaeadiekivrwvltlk

SCOPe Domain Coordinates for d2d0sa_:

Click to download the PDB-style file with coordinates for d2d0sa_.
(The format of our PDB-style files is described here.)

Timeline for d2d0sa_: