SCOPe 2.03: Domain d1bdca_: 1bdc A:

Lineage for d1bdca_ (1bdc A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families)

5. Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
   automatically mapped to Pfam PF02216

6. Protein Immunoglobulin-binding protein A modules [46999] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [47000] (14 PDB entries)

8. Domain d1bdca_: 1bdc A: [16350]
   domain B

Details for d1bdca_

PDB Entry: 1bdc

PDB Description: staphylococcus aureus protein a, immunoglobulin-binding b domain, nmr, 10 structures

PDB Compounds: (A:) staphylococcus aureus protein a

SCOPe Domain Sequences for d1bdca_:

Sequence; same for both SEQRES and ATOM records:

>d1bdca_ a.8.1.1 (A:) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
tadnkfnkeqqnafyeilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqapka

Timeline for d1bdca_:

• d1bdca_ first appeared (with stable ids) in SCOP 1.55, called d1bdc__
  
• d1bdca_ appears in SCOPe 2.02
  
• d1bdca_ appears in SCOPe 2.04
  
• d1bdca_ appears in the current release, SCOPe 2.08