Lineage for d2cwsa_ (2cws A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1782141Species Sphingomonas sp. [TaxId:90322] [187577] (4 PDB entries)
  8. 1782142Domain d2cwsa_: 2cws A: [163484]
    automated match to d1vava_
    complexed with gol, so4

Details for d2cwsa_

PDB Entry: 2cws (more details), 1 Å

PDB Description: Crystal structure at 1.0 A of alginate lyase A1-II', a member of polysaccharide lyase family-7
PDB Compounds: (A:) alginate lyase A1-II'

SCOPe Domain Sequences for d2cwsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwsa_ b.29.1.0 (A:) automated matches {Sphingomonas sp. [TaxId: 90322]}
aapgknfdlshwklqlpdantteissanlglgytsqyfytdtdgamtfwapttggttans
syprselremldpsnskvnwgwqgthtmklsgktvqlpssgkiivaqihgimddgtnapp
lvkavfqdgqldmqvkqnsdgtgsdvhnyftgiklgdlynmeirvtdgvayvtmngdtrs
vdfvgkdagwknlkyyfkagnyvqdntstggsaiaklyslsvshsnl

SCOPe Domain Coordinates for d2cwsa_:

Click to download the PDB-style file with coordinates for d2cwsa_.
(The format of our PDB-style files is described here.)

Timeline for d2cwsa_: