Lineage for d1edj__ (1edj -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1903Fold a.8: Bacterial immunoglobulin/albumin-binding domains [46996] (1 superfamily)
  4. 1904Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families) (S)
  5. 1905Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (1 protein)
  6. 1906Protein Immunoglobulin-binding protein A modules [46999] (1 species)
  7. 1907Species Staphylococcus aureus [TaxId:1280] [47000] (9 PDB entries)
  8. 1911Domain d1edj__: 1edj - [16346]

Details for d1edj__

PDB Entry: 1edj (more details)

PDB Description: staphylococcal protein a e-domain (180), nmr, 20 structures

SCOP Domain Sequences for d1edj__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1edj__ a.8.1.1 (-) Immunoglobulin-binding protein A modules {Staphylococcus aureus}
aqhdeaqqnafyqvlnmpnlnadqrngfiqslkddpsqsanvlgeaqklndsqapk

SCOP Domain Coordinates for d1edj__:

Click to download the PDB-style file with coordinates for d1edj__.
(The format of our PDB-style files is described here.)

Timeline for d1edj__: