Lineage for d2cmld_ (2cml D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2807607Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2807608Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2807621Protein Influenza neuraminidase [50943] (9 species)
  7. 2807670Species Influenza A virus, different strains [TaxId:11320] [50944] (89 PDB entries)
    Uniprot P03472 84-470
  8. 2807748Domain d2cmld_: 2cml D: [163451]
    automated match to d5nn9a_
    complexed with bma, ca, man, nag, zmr

Details for d2cmld_

PDB Entry: 2cml (more details), 2.15 Å

PDB Description: structure of neuraminidase from english duck subtype n6 complexed with 30 mm zanamivir, crystal soaked for 3 hours at 291 k.
PDB Compounds: (D:) Neuraminidase

SCOPe Domain Sequences for d2cmld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cmld_ b.68.1.1 (D:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
snsivalcgskkrlgswswhdgaeiiyfe

SCOPe Domain Coordinates for d2cmld_:

Click to download the PDB-style file with coordinates for d2cmld_.
(The format of our PDB-style files is described here.)

Timeline for d2cmld_: