Lineage for d1fc2c_ (1fc2 C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1261719Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1261720Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families) (S)
  5. 1261721Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 1261722Protein Immunoglobulin-binding protein A modules [46999] (1 species)
  7. 1261723Species Staphylococcus aureus [TaxId:1280] [47000] (14 PDB entries)
  8. 1261728Domain d1fc2c_: 1fc2 C: [16345]
    Other proteins in same PDB: d1fc2d1, d1fc2d2
    domain B, incomplete
    complexed with so4

Details for d1fc2c_

PDB Entry: 1fc2 (more details), 2.8 Å

PDB Description: crystallographic refinement and atomic models of a human fc fragment and its complex with fragment b of protein a from staphylococcus aureus at 2.9-and 2.8-angstroms resolution
PDB Compounds: (C:) fragment b of protein a complex

SCOPe Domain Sequences for d1fc2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fc2c_ a.8.1.1 (C:) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
fnkeqqnafyeilhlpnlneeqrngfiqslkddpsqsanllaea

SCOPe Domain Coordinates for d1fc2c_:

Click to download the PDB-style file with coordinates for d1fc2c_.
(The format of our PDB-style files is described here.)

Timeline for d1fc2c_: