Lineage for d2cmja_ (2cmj A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2155664Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2155665Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2155666Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2155825Protein automated matches [190072] (19 species)
    not a true protein
  7. 2155908Species Mouse (Mus musculus) [TaxId:10090] [187557] (3 PDB entries)
  8. 2155909Domain d2cmja_: 2cmj A: [163446]
    automated match to d1t09a_
    complexed with nap

Details for d2cmja_

PDB Entry: 2cmj (more details), 1.99 Å

PDB Description: crystal structure of mouse cytosolic isocitrate dehydrogenase
PDB Compounds: (A:) isocitrate dehydrogenase [nadp] cytoplasmic

SCOPe Domain Sequences for d2cmja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cmja_ c.77.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kiqggsvvemqgdemtriiwelikeklilpyveldlhsydlgienrdatndqvtkdaaea
ikkynvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvtg
wvkpiiigrhaygdqyratdfvvpgpgkveitytpkdgtqkvtymvhdfeegggvamgmy
nqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkkyksqfeaqn
icyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlicpdgktv
eaeaahgtvtrhyrmyqkgqetstnpiasifawsrglahrakldnntelsffakaledvc
ietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkaklaqak

SCOPe Domain Coordinates for d2cmja_:

Click to download the PDB-style file with coordinates for d2cmja_.
(The format of our PDB-style files is described here.)

Timeline for d2cmja_: