Lineage for d1deeh_ (1dee H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310325Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2310326Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2310327Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 2310328Protein Immunoglobulin-binding protein A modules [46999] (1 species)
  7. 2310329Species Staphylococcus aureus [TaxId:1280] [47000] (24 PDB entries)
  8. 2310338Domain d1deeh_: 1dee H: [16344]
    Other proteins in same PDB: d1deea1, d1deea2, d1deeb1, d1deeb2, d1deec1, d1deec2, d1deed1, d1deed2, d1deee1, d1deee2, d1deef1, d1deef2
    domain D

Details for d1deeh_

PDB Entry: 1dee (more details), 2.7 Å

PDB Description: structure of s. aureus protein a bound to a human igm fab
PDB Compounds: (H:) immunoglobulin g binding protein a

SCOPe Domain Sequences for d1deeh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deeh_ a.8.1.1 (H:) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
fnkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqapk

SCOPe Domain Coordinates for d1deeh_:

Click to download the PDB-style file with coordinates for d1deeh_.
(The format of our PDB-style files is described here.)

Timeline for d1deeh_: