Lineage for d2cksa_ (2cks A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1146973Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1146974Protein automated matches [190075] (30 species)
    not a true protein
  7. 1147082Species Thermobifida fusca [TaxId:2021] [187554] (2 PDB entries)
  8. 1147083Domain d2cksa_: 2cks A: [163433]
    automated match to d1lf1a_
    complexed with ben, na, zn

Details for d2cksa_

PDB Entry: 2cks (more details), 1.6 Å

PDB Description: x-ray crystal structure of the catalytic domain of thermobifida fusca endoglucanase cel5a (e5)
PDB Compounds: (A:) endoglucanase e-5

SCOPe Domain Sequences for d2cksa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cksa_ c.1.8.0 (A:) automated matches {Thermobifida fusca [TaxId: 2021]}
gtpverygkvqvcgtqlcdehgnpvqlrgmsthgiqwfdhcltdssldalaydwkadiir
lsmyiqedgyetnprgftdrmhqlidmatarglyvivdwhiltpgdphynldraktffae
iaqrhasktnvlyeianepngvswasiksyaeevipvirqrdpdsviivgtrgwsslgvs
egsgpaeiaanpvnasnimyafhfyaashrdnylnalreaselfpvfvtefgtetytgdg
andfqmadryidlmaerkigwtkwnysddfrsgavfqpgtcasggpwsgsslkasgqwvr
sklqs

SCOPe Domain Coordinates for d2cksa_:

Click to download the PDB-style file with coordinates for d2cksa_.
(The format of our PDB-style files is described here.)

Timeline for d2cksa_: