Lineage for d2ckrb_ (2ckr B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969862Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 971534Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 971535Protein automated matches [190075] (16 species)
    not a true protein
  7. 971592Species Thermobifida fusca [TaxId:2021] [187554] (2 PDB entries)
  8. 971596Domain d2ckrb_: 2ckr B: [163432]
    automated match to d1lf1a_
    complexed with ben, na, pg4, zn

Details for d2ckrb_

PDB Entry: 2ckr (more details), 1.77 Å

PDB Description: x-ray crystal structure of the catalytic domain of thermobifida fusca endoglucanase cel5a (e5) e355q in complex with cellotetraose
PDB Compounds: (B:) endoglucanase e-5

SCOPe Domain Sequences for d2ckrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckrb_ c.1.8.0 (B:) automated matches {Thermobifida fusca [TaxId: 2021]}
gtpverygkvqvcgtqlcdehgnpvqlrgmsthgiqwfdhcltdssldalaydwkadiir
lsmyiqedgyetnprgftdrmhqlidmatarglyvivdwhiltpgdphynldraktffae
iaqrhasktnvlyeianepngvswasiksyaeevipvirqrdpdsviivgtrgwsslgvs
egsgpaeiaanpvnasnimyafhfyaashrdnylnalreaselfpvfvtqfgtetytgdg
andfqmadryidlmaerkigwtkwnysddfrsgavfqpgtcasggpwsgsslkasgqwvr
sklqs

SCOPe Domain Coordinates for d2ckrb_:

Click to download the PDB-style file with coordinates for d2ckrb_.
(The format of our PDB-style files is described here.)

Timeline for d2ckrb_: