Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
Protein automated matches [190205] (26 species) not a true protein |
Species Sphingomonas sp. [TaxId:279135] [187555] (1 PDB entry) |
Domain d2ckfb_: 2ckf B: [163426] Other proteins in same PDB: d2ckfa1, d2ckfa2, d2ckfc1, d2ckfc2, d2ckfe1, d2ckfe2 automated match to d1ulid_ complexed with fe, fes |
PDB Entry: 2ckf (more details), 1.85 Å
SCOPe Domain Sequences for d2ckfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ckfb_ d.17.4.0 (B:) automated matches {Sphingomonas sp. [TaxId: 279135]} qvpvtpdvhyaveahyraevrllqtgqyrewlhgmvaedihywmpiyeqrfvrdrrpdpt pddaaiynddfeelkqrverlysgqvwmedppskiryfvsnveafeaengeldvlsnilv yrnrrqtevtvhtlgredklrqdgngfkvfrrklildarvtqdknlyffc
Timeline for d2ckfb_: