SCOPe 2.01: Domain d2cjwb_: 2cjw B:

Lineage for d2cjwb_ (2cjw B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (67 PDB entries)

8. Domain d2cjwb_: 2cjw B: [163424]
   automated match to d2g3ya1
   complexed with gdp, mg

Details for d2cjwb_

PDB Entry: 2cjw, 2.1 Å

PDB Description: crystal structure of the small gtpase gem (gemdndcam) in complex to mg.gdp

PDB Compounds: (B:) GTP-binding protein gem

SCOPe Domain Sequences for d2cjwb_:

Sequence, based on SEQRES records:

>d2cjwb_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efgmtyyrvvligeqgvgkstlanifagvhdsmdsdcevlgedtyertlmvdgesatiil
ldmwenkgenewlhdhcmqvgdaylivysitdrasfekaselriqlrrarqtedipiilv
gnksdlvrcrevsvsegracavvfdckfietsaavqhnvkelfegivrqvrlrrdskekn
errlayqkrkes

Sequence, based on observed residues (ATOM records):

>d2cjwb_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efgmtyyrvvligeqgvgkstlanifagvedtyertlmvdgesatiilldmwenhdhcmq
vgdaylivysitdrasfekaselriqlrrarqtedipiilvgnksdlvrcrevsvsegra
cavvfdckfietsaavqhnvkelfegivrqvrlrrdskeknerrlayqkrkes

Timeline for d2cjwb_:

• d2cjwb_ is new in SCOPe 2.01-stable
  
• d2cjwb_ appears in SCOPe 2.02
  
• d2cjwb_ appears in the current release, SCOPe 2.08