Lineage for d2cjlb_ (2cjl B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013435Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1013436Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1014821Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 1014822Protein automated matches [190563] (6 species)
    not a true protein
  7. 1014841Species Streptomyces coelicolor [TaxId:1902] [187551] (1 PDB entry)
  8. 1014843Domain d2cjlb_: 2cjl B: [163421]
    automated match to d1cnsa_
    complexed with zn

Details for d2cjlb_

PDB Entry: 2cjl (more details), 1.5 Å

PDB Description: crystal structure and enzymatic properties of a bacterial family 19 chitinase reveal differences with plant enzymes
PDB Compounds: (B:) secreted chitinase

SCOPe Domain Sequences for d2cjlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cjlb_ d.2.1.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
fvvseaqfdqmfpsrnsfytysgltaalsaypgfsntgsdtvkkqeaaaflanvghetgg
lvyvveqntanyphycdasqpygcpagndkyygrgpvqlswnfnykaagdalgidllnnp
dlvqndsavawktglwywntqtgpgtmtphdamvngagfgetirsingslecdggnpgqv
qsridnyerftqllgvepggnlsc

SCOPe Domain Coordinates for d2cjlb_:

Click to download the PDB-style file with coordinates for d2cjlb_.
(The format of our PDB-style files is described here.)

Timeline for d2cjlb_: