SCOPe 2.01: Domain d2cjlb_: 2cjl B:

Lineage for d2cjlb_ (2cjl B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.0: automated matches [191411] (1 protein)
   not a true family

6. Protein automated matches [190563] (6 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:1902] [187551] (1 PDB entry)

8. Domain d2cjlb_: 2cjl B: [163421]
   automated match to d1cnsa_
   complexed with zn

Details for d2cjlb_

PDB Entry: 2cjl, 1.5 Å

PDB Description: crystal structure and enzymatic properties of a bacterial family 19 chitinase reveal differences with plant enzymes

PDB Compounds: (B:) secreted chitinase

SCOPe Domain Sequences for d2cjlb_:

Sequence; same for both SEQRES and ATOM records:

>d2cjlb_ d.2.1.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
fvvseaqfdqmfpsrnsfytysgltaalsaypgfsntgsdtvkkqeaaaflanvghetgg
lvyvveqntanyphycdasqpygcpagndkyygrgpvqlswnfnykaagdalgidllnnp
dlvqndsavawktglwywntqtgpgtmtphdamvngagfgetirsingslecdggnpgqv
qsridnyerftqllgvepggnlsc

Timeline for d2cjlb_:

• d2cjlb_ is new in SCOPe 2.01-stable
  
• d2cjlb_ appears in SCOPe 2.02
  
• d2cjlb_ appears in the current release, SCOPe 2.08