SCOP 1.63: Domain d1hnxt_: 1hnx T:

Lineage for d1hnxt_ (1hnx T:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family)

5. Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
   this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain

6. Protein Ribosomal protein S20 [46994] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46995] (14 PDB entries)

8. Domain d1hnxt_: 1hnx T: [16342]
   Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxv_
   complexed with mg, pcy, zn

Details for d1hnxt_

PDB Entry: 1hnx, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

SCOP Domain Sequences for d1hnxt_:

Sequence; same for both SEQRES and ATOM records:

>d1hnxt_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus}
rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

Timeline for d1hnxt_:

• d1hnxt_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnxt_ appears in SCOP 1.61
  
• d1hnxt_ appears in SCOP 1.65
  
• d1hnxt_ appears in the current release, SCOPe 2.08