SCOPe 2.07: Domain d2ci5a_: 2ci5 A:

Lineage for d2ci5a_ (2ci5 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
   duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis

4. Superfamily d.126.1: Pentein [55909] (8 families)

5. Family d.126.1.0: automated matches [191334] (1 protein)
   not a true family

6. Protein automated matches [190175] (10 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187514] (7 PDB entries)

8. Domain d2ci5a_: 2ci5 A: [163409]
   automated match to d1h70a_
   complexed with cit, hcs

Details for d2ci5a_

PDB Entry: 2ci5, 1.79 Å

PDB Description: crystal structure of dimethylarginine dimethylaminohydrolase i in complex with l-homocysteine

PDB Compounds: (A:) ng, ng-dimethylarginine dimethylaminohydrolase 1

SCOPe Domain Sequences for d2ci5a_:

Sequence; same for both SEQRES and ATOM records:

>d2ci5a_ d.126.1.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
fgrathvvvralpeslaqqalrrtkgdevdfaraerqhqlyvgvlgsklglqvvqlpade
slpdcvfvedvavvceetalitrpgapsrrkeadmmkealeklqlnivemkdenatldgg
dvlftgreffvglskrtnqrgaeiladtfkdyavstvpvvdalhlksfcsmagpnliaig
ssesaqkalkimqqmsdhrydkltvpddtaanciylnipskghvllhrtpeeypesakvy
eklkdhmlipvsnselekvdglltcssvlink

Timeline for d2ci5a_:

• d2ci5a_ first appeared in SCOPe 2.01
  
• d2ci5a_ appears in SCOPe 2.06
  
• d2ci5a_ appears in the current release, SCOPe 2.08