Lineage for d1hr0t_ (1hr0 T:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534473Fold a.7: Spectrin repeat-like [46965] (13 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 534573Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 534574Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 534575Protein Ribosomal protein S20 [46994] (1 species)
  7. 534576Species Thermus thermophilus [TaxId:274] [46995] (18 PDB entries)
  8. 534580Domain d1hr0t_: 1hr0 T: [16339]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0v_, d1hr0w_
    complexed with mg, zn

Details for d1hr0t_

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

SCOP Domain Sequences for d1hr0t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0t_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus}
rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d1hr0t_:

Click to download the PDB-style file with coordinates for d1hr0t_.
(The format of our PDB-style files is described here.)

Timeline for d1hr0t_: