Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (18 species) not a true protein |
Species Streptococcus suis [TaxId:1307] [187539] (1 PDB entry) |
Domain d2cf7d_: 2cf7 D: [163384] automated match to d1umng_ complexed with ca, cl, epe; mutant |
PDB Entry: 2cf7 (more details), 1.5 Å
SCOPe Domain Sequences for d2cf7d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cf7d_ a.25.1.1 (D:) automated matches {Streptococcus suis [TaxId: 1307]} sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgylaemserl itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg dsvtndifnvakasiekhiwmlqaelgqapkl
Timeline for d2cf7d_: