SCOPe 2.06: Domain d2ccja_: 2ccj A:

Lineage for d2ccja_ (2ccj A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [187532] (5 PDB entries)

8. Domain d2ccja_: 2ccj A: [163368]
   automated match to d4tmka_
   complexed with cl, edo, tmp

Details for d2ccja_

PDB Entry: 2ccj, 1.7 Å

PDB Description: crystal structure of s. aureus thymidylate kinase complexed with thymidine monophosphate

PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d2ccja_:

Sequence, based on SEQRES records:

>d2ccja_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikyleki

Sequence, based on observed residues (ATOM records):

>d2ccja_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsnrldqedlkfhekviegyqeiihrfksvnadqple
nvvedtyqtiikyleki

Timeline for d2ccja_:

• d2ccja_ first appeared in SCOPe 2.01
  
• d2ccja_ appears in SCOPe 2.05
  
• d2ccja_ appears in SCOPe 2.07
  
• d2ccja_ appears in the current release, SCOPe 2.08