Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein automated matches [190545] (9 species) not a true protein |
Species Thiobacillus ferrooxidans [TaxId:920] [187525] (1 PDB entry) |
Domain d2cala_: 2cal A: [163353] automated match to d1cura_ complexed with cu1 |
PDB Entry: 2cal (more details), 1.1 Å
SCOPe Domain Sequences for d2cala_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cala_ b.6.1.1 (A:) automated matches {Thiobacillus ferrooxidans [TaxId: 920]} ldttwkeatlpqvkamlekdtgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkknp tleipagatvdvtfintnkgfghsfditkkgppyavmpvidpivagtgfspvpkdgkfgy tdftwhptagtyyyvcqipgmaatgmfgkivvk
Timeline for d2cala_: