Lineage for d2cala_ (2cal A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770993Protein automated matches [190545] (9 species)
    not a true protein
  7. 2771041Species Thiobacillus ferrooxidans [TaxId:920] [187525] (1 PDB entry)
  8. 2771042Domain d2cala_: 2cal A: [163353]
    automated match to d1cura_
    complexed with cu1

Details for d2cala_

PDB Entry: 2cal (more details), 1.1 Å

PDB Description: crystal structure of his143met rusticyanin
PDB Compounds: (A:) rusticyanin

SCOPe Domain Sequences for d2cala_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cala_ b.6.1.1 (A:) automated matches {Thiobacillus ferrooxidans [TaxId: 920]}
ldttwkeatlpqvkamlekdtgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkknp
tleipagatvdvtfintnkgfghsfditkkgppyavmpvidpivagtgfspvpkdgkfgy
tdftwhptagtyyyvcqipgmaatgmfgkivvk

SCOPe Domain Coordinates for d2cala_:

Click to download the PDB-style file with coordinates for d2cala_.
(The format of our PDB-style files is described here.)

Timeline for d2cala_: