SCOPe 2.01: Domain d2c9ra_: 2c9r A:

Lineage for d2c9ra_ (2c9r A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein)

6. Protein Copper resistance protein C (CopC, PcoC) [81970] (3 species)

7. Species Pseudomonas syringae [TaxId:317] [81971] (4 PDB entries)

8. Domain d2c9ra_: 2c9r A: [163352]
   automated match to d1m42a_
   complexed with na

Details for d2c9ra_

PDB Entry: 2c9r, 2 Å

PDB Description: apo-h91f copc

PDB Compounds: (A:) copper resistance protein c

SCOPe Domain Sequences for d2c9ra_:

Sequence, based on SEQRES records:

>d2c9ra_ b.1.18.17 (A:) Copper resistance protein C (CopC, PcoC) {Pseudomonas syringae [TaxId: 317]}
hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
gdpktmvitpaspltagtykvdwravssdtfpitgsvtfkvk

Sequence, based on observed residues (ATOM records):

>d2c9ra_ b.1.18.17 (A:) Copper resistance protein C (CopC, PcoC) {Pseudomonas syringae [TaxId: 317]}
hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtamppmavkaavsgggdpkt
mvitpaspltagtykvdwravssdtfpitgsvtfkvk

Timeline for d2c9ra_:

• d2c9ra_ is new in SCOPe 2.01-stable
  
• d2c9ra_ appears in SCOPe 2.02
  
• d2c9ra_ appears in the current release, SCOPe 2.08