Class a: All alpha proteins [46456] (290 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) |
Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins) |
Protein Fumarate reductase [46981] (2 species) |
Species Wolinella succinogenes [TaxId:844] [46983] (6 PDB entries) |
Domain d1qlbd1: 1qlb D:458-655 [16331] Other proteins in same PDB: d1qlba2, d1qlba3, d1qlbb1, d1qlbb2, d1qlbc_, d1qlbd2, d1qlbd3, d1qlbe1, d1qlbe2, d1qlbf_ complexed with ca, f3s, fad, fes, fum, hem, lmt, sf4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1qlb (more details), 2.33 Å
SCOPe Domain Sequences for d1qlbd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlbd1 a.7.3.1 (D:458-655) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} kgtedvfkiknrmkdvmddnvgifrdgphleksvkeleelykksknvgiknkrlhanpel eeayrvpmmlkvalcvakgaldrtesrgahnredypkrddinwlnrtlaswpnpeqtlpt leyealdvnemeiapryrgygakgnyienplsvkrqeeidkiqseleaagkdrhaiqeal mpyelpakykarnerlgd
Timeline for d1qlbd1: