Lineage for d1qlbd1 (1qlb D:458-655)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696597Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 2696598Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 2696605Protein Fumarate reductase [46981] (2 species)
  7. 2696617Species Wolinella succinogenes [TaxId:844] [46983] (6 PDB entries)
  8. 2696625Domain d1qlbd1: 1qlb D:458-655 [16331]
    Other proteins in same PDB: d1qlba2, d1qlba3, d1qlbb1, d1qlbb2, d1qlbc_, d1qlbd2, d1qlbd3, d1qlbe1, d1qlbe2, d1qlbf_
    complexed with ca, f3s, fad, fes, fum, hem, lmt, sf4
    has additional insertions and/or extensions that are not grouped together

Details for d1qlbd1

PDB Entry: 1qlb (more details), 2.33 Å

PDB Description: respiratory complex II-like fumarate reductase from Wolinella succinogenes
PDB Compounds: (D:) Fumarate reductase flavoprotein subunit

SCOPe Domain Sequences for d1qlbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlbd1 a.7.3.1 (D:458-655) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
kgtedvfkiknrmkdvmddnvgifrdgphleksvkeleelykksknvgiknkrlhanpel
eeayrvpmmlkvalcvakgaldrtesrgahnredypkrddinwlnrtlaswpnpeqtlpt
leyealdvnemeiapryrgygakgnyienplsvkrqeeidkiqseleaagkdrhaiqeal
mpyelpakykarnerlgd

SCOPe Domain Coordinates for d1qlbd1:

Click to download the PDB-style file with coordinates for d1qlbd1.
(The format of our PDB-style files is described here.)

Timeline for d1qlbd1: