SCOPe 2.01: Domain d2c81a_: 2c81 A:

Lineage for d2c81a_ (2c81 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (25 species)
   not a true protein

7. Species Bacillus circulans [TaxId:1397] [187516] (2 PDB entries)

8. Domain d2c81a_: 2c81 A: [163296]
   automated match to d1b9ha_
   complexed with pmp

Details for d2c81a_

PDB Entry: 2c81, 1.7 Å

PDB Description: crystal structures of the plp- and pmp-bound forms of btrr, a dual functional aminotransferase involved in butirosin biosynthesis.

PDB Compounds: (A:) glutamine-2-deoxy-scyllo-inosose aminotransferase

SCOPe Domain Sequences for d2c81a_:

Sequence; same for both SEQRES and ATOM records:

>d2c81a_ c.67.1.0 (A:) automated matches {Bacillus circulans [TaxId: 1397]}
wpewpqhsdrtrrkieevfqsnrwaisgywtgeesmerkfakafadfngvpycvpttsgs
talmlalealgigegdevivpsltwiatatavlnvnalpvfvdveadtycidpqliksai
tdktkaiipvhlfgsmanmdeineiaqehnlfviedcaqshgsvwnnqragtigdigafs
cqqgkvltageggiivtknprlfeliqqlradsrvycddsselmhgdmqlvkkgdiqgsn
yclsefqsailldqlqelddknaireknamflndalskidgikvmkrppqvsrqtyygyv
frfdpvkfgglnadqfceilreklnmgtfylhppylpvhknplfcpwtknrylksvrkte
aywrglhypvserasgqsivihhaillaepshlsllvdavaelarkfcv

Timeline for d2c81a_:

• d2c81a_ is new in SCOPe 2.01-stable
  
• d2c81a_ appears in SCOPe 2.02
  
• d2c81a_ appears in the current release, SCOPe 2.08