Lineage for d1fumm1 (1fum M:443-575)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 95722Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)
  4. 95756Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase C-terminal domain [46977] (1 family) (S)
  5. 95757Family a.7.3.1: Succinate dehydrogenase/fumarate reductase C-terminal domain [46978] (3 proteins)
  6. 95762Protein Fumarate reductase flavoprotein subunit [46981] (2 species)
  7. 95763Species Escherichia coli [TaxId:562] [46982] (1 PDB entry)
  8. 95765Domain d1fumm1: 1fum M:443-575 [16327]
    Other proteins in same PDB: d1fuma2, d1fuma3, d1fumb1, d1fumb2, d1fumc_, d1fumd_, d1fumm2, d1fumm3, d1fumn1, d1fumn2, d1fumo_, d1fump_

Details for d1fumm1

PDB Entry: 1fum (more details), 3.3 Å

PDB Description: structure of the e. coli fumarate reductase respiratory complex

SCOP Domain Sequences for d1fumm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fumm1 a.7.3.1 (M:443-575) Fumarate reductase flavoprotein subunit {Escherichia coli}
dggenwakirdemglameegcgiyrtpelmqktidklaelqerfkrvritdtssvfntdl
lytielghglnvaecmahsamarkesrgahqrldegcterddvnflkhtlafrdadgttr
leysdvkittlpp

SCOP Domain Coordinates for d1fumm1:

Click to download the PDB-style file with coordinates for d1fumm1.
(The format of our PDB-style files is described here.)

Timeline for d1fumm1: