![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) ![]() |
![]() | Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins) |
![]() | Protein automated matches [190540] (4 species) not a true protein |
![]() | Species Human herpesvirus 1 [TaxId:10298] [187512] (2 PDB entries) |
![]() | Domain d2c53a_: 2c53 A: [163262] automated match to d1laue_ complexed with dur, gol |
PDB Entry: 2c53 (more details), 1.8 Å
SCOPe Domain Sequences for d2c53a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c53a_ c.18.1.1 (A:) automated matches {Human herpesvirus 1 [TaxId: 10298]} ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct pdevrvviigqnpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai rpdprvhcvlkfsnpsplskvpfgtcqhflvanryletrsispidwsv
Timeline for d2c53a_: