SCOPe 2.04: Domain d2c53a_: 2c53 A:

Lineage for d2c53a_ (2c53 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein automated matches [190540] (4 species)
   not a true protein

7. Species Human herpesvirus 1 [TaxId:10298] [187512] (2 PDB entries)

8. Domain d2c53a_: 2c53 A: [163262]
   automated match to d1laue_
   complexed with dur, gol

Details for d2c53a_

PDB Entry: 2c53, 1.8 Å

PDB Description: a comparative study of uracil dna glycosylases from human and herpes simplex virus type 1

PDB Compounds: (A:) uracil DNA glycosylase

SCOPe Domain Sequences for d2c53a_:

Sequence; same for both SEQRES and ATOM records:

>d2c53a_ c.18.1.1 (A:) automated matches {Human herpesvirus 1 [TaxId: 10298]}
ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
pdevrvviigqnpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
rpdprvhcvlkfsnpsplskvpfgtcqhflvanryletrsispidwsv

Timeline for d2c53a_:

• d2c53a_ first appeared in SCOPe 2.01
  
• d2c53a_ appears in SCOPe 2.03
  
• d2c53a_ appears in SCOPe 2.05
  
• d2c53a_ appears in the current release, SCOPe 2.08