Lineage for d1fuma1 (1fum A:443-575)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45997Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)
  4. 46031Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase C-terminal domain [46977] (1 family) (S)
  5. 46032Family a.7.3.1: Succinate dehydrogenase/fumarate reductase C-terminal domain [46978] (2 proteins)
  6. 46033Protein Fumarate reductase flavoprotein subunit [46981] (2 species)
  7. 46034Species Escherichia coli [TaxId:562] [46982] (1 PDB entry)
  8. 46035Domain d1fuma1: 1fum A:443-575 [16326]
    Other proteins in same PDB: d1fuma2, d1fuma3, d1fumb1, d1fumb2, d1fumc_, d1fumd_, d1fumm2, d1fumm3, d1fumn1, d1fumn2, d1fumo_, d1fump_

Details for d1fuma1

PDB Entry: 1fum (more details), 3.3 Å

PDB Description: structure of the e. coli fumarate reductase respiratory complex

SCOP Domain Sequences for d1fuma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fuma1 a.7.3.1 (A:443-575) Fumarate reductase flavoprotein subunit {Escherichia coli}
dggenwakirdemglameegcgiyrtpelmqktidklaelqerfkrvritdtssvfntdl
lytielghglnvaecmahsamarkesrgahqrldegcterddvnflkhtlafrdadgttr
leysdvkittlpp

SCOP Domain Coordinates for d1fuma1:

Click to download the PDB-style file with coordinates for d1fuma1.
(The format of our PDB-style files is described here.)

Timeline for d1fuma1: