Lineage for d1chua1 (1chu A:423-533)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309866Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2309960Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 2309961Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 2309995Protein L-aspartate oxidase [46979] (1 species)
  7. 2309996Species Escherichia coli [TaxId:562] [46980] (3 PDB entries)
  8. 2309997Domain d1chua1: 1chu A:423-533 [16325]
    Other proteins in same PDB: d1chua2, d1chua3

Details for d1chua1

PDB Entry: 1chu (more details), 2.2 Å

PDB Description: structure of l-aspartate oxidase: implications for the succinate dehydrogenase/ fumarate reducatse family
PDB Compounds: (A:) protein (l-aspartate oxidase)

SCOPe Domain Sequences for d1chua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chua1 a.7.3.1 (A:423-533) L-aspartate oxidase {Escherichia coli [TaxId: 562]}
desrvenpdervviqhnwhelrlfmwdyvgivrttkrleralrritmlqqeideyyahfr
vsnnllelrnlvqvaelivrcammrkesrglhftldypellthsgpsilsp

SCOPe Domain Coordinates for d1chua1:

Click to download the PDB-style file with coordinates for d1chua1.
(The format of our PDB-style files is described here.)

Timeline for d1chua1: