SCOPe 2.08: Domain d2c15a_: 2c15 A:

Lineage for d2c15a_ (2c15 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins)
   hybrid of classes I and II aldolase
   automatically mapped to Pfam PF00490

6. Protein automated matches [190088] (4 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [187506] (8 PDB entries)

8. Domain d2c15a_: 2c15 A: [163215]
   automated match to d1gzgb_
   complexed with mg

Details for d2c15a_

PDB Entry: 2c15, 1.48 Å

PDB Description: 5-(4-carboxy-2-oxo-butoxy)-4-oxo-pentanoic acid acid bound to porphobilinogen synthase from pseudomonas aeruginosa

PDB Compounds: (A:) delta-aminolevulinic acid dehydratase

SCOPe Domain Sequences for d2c15a_:

Sequence; same for both SEQRES and ATOM records:

>d2c15a_ c.1.10.3 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ftpanraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgver
lsidqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpel
giitdvaldpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgri
gairealesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansdea
lhevaadlaegadmvmvxpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwla
esvilesltafkragadgiltyfakqaaeqlrrg

Timeline for d2c15a_:

• d2c15a_ first appeared in SCOPe 2.01
  
• d2c15a_ appears in SCOPe 2.07