Lineage for d2bw7c_ (2bw7 C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1910831Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 1910832Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 1910893Protein automated matches [190310] (3 species)
    not a true protein
  7. 1910898Species Spirulina platensis [TaxId:118562] [187494] (1 PDB entry)
  8. 1910901Domain d2bw7c_: 2bw7 C: [163192]
    automated match to d1wc4a_
    complexed with apc, ca, ecs, mg

Details for d2bw7c_

PDB Entry: 2bw7 (more details), 2.3 Å

PDB Description: a novel mechanism for adenylyl cyclase inhibition from the crystal structure of its complex with catechol estrogen
PDB Compounds: (C:) adenylate cyclase

SCOPe Domain Sequences for d2bw7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bw7c_ d.58.29.1 (C:) automated matches {Spirulina platensis [TaxId: 118562]}
mrpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdai
malygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgihqg
mavvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflel
kgidepvmtcvinpnm

SCOPe Domain Coordinates for d2bw7c_:

Click to download the PDB-style file with coordinates for d2bw7c_.
(The format of our PDB-style files is described here.)

Timeline for d2bw7c_: