SCOPe 2.08: Domain d2bw7a1: 2bw7 A:1005-1199

Lineage for d2bw7a1 (2bw7 A:1005-1199)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (3 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
   Pfam PF00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein automated matches [190310] (3 species)
   not a true protein

7. Species Spirulina platensis [TaxId:118562] [187494] (1 PDB entry)

8. Domain d2bw7a1: 2bw7 A:1005-1199 [163190]
   Other proteins in same PDB: d2bw7a2, d2bw7b2, d2bw7c2
   automated match to d1wc4a_
   complexed with apc, ca, ecs, mg

Details for d2bw7a1

PDB Entry: 2bw7, 2.3 Å

PDB Description: a novel mechanism for adenylyl cyclase inhibition from the crystal structure of its complex with catechol estrogen

PDB Compounds: (A:) adenylate cyclase

SCOPe Domain Sequences for d2bw7a1:

Sequence; same for both SEQRES and ATOM records:

>d2bw7a1 d.58.29.1 (A:1005-1199) automated matches {Spirulina platensis [TaxId: 118562]}
rpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdaim
alygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgihqgm
avvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflelk
gidepvmtcvinpnm

Timeline for d2bw7a1:

• d2bw7a1 first appeared in SCOPe 2.01, called d2bw7a_
  
• d2bw7a1 appears in SCOPe 2.07