SCOPe 2.05: Domain d2bsee_: 2bse E:

Lineage for d2bsee_ (2bse E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (93 PDB entries)

8. Domain d2bsee_: 2bse E: [163158]
   Other proteins in same PDB: d2bsea_, d2bseb_, d2bsec_
   automated match to d1g9ea_

Details for d2bsee_

PDB Entry: 2bse, 2.7 Å

PDB Description: structure of lactococcal bacteriophage p2 receptor binding protein in complex with a llama vhh domain

PDB Compounds: (E:) llama immunoglobulin

SCOPe Domain Sequences for d2bsee_:

Sequence; same for both SEQRES and ATOM records:

>d2bsee_ b.1.1.1 (E:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyya
dsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvtv
ss

Timeline for d2bsee_:

• d2bsee_ first appeared in SCOPe 2.01
  
• d2bsee_ appears in SCOPe 2.04
  
• d2bsee_ appears in SCOPe 2.06
  
• d2bsee_ appears in the current release, SCOPe 2.08, called d2bsee1