Lineage for d2bsed_ (2bse D:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105645Protein automated matches [190119] (15 species)
    not a true protein
  7. 1105754Species Llama (Lama glama) [TaxId:9844] [187485] (23 PDB entries)
  8. 1105796Domain d2bsed_: 2bse D: [163157]
    automated match to d1g9ea_

Details for d2bsed_

PDB Entry: 2bse (more details), 2.7 Å

PDB Description: structure of lactococcal bacteriophage p2 receptor binding protein in complex with a llama vhh domain
PDB Compounds: (D:) llama immunoglobulin

SCOPe Domain Sequences for d2bsed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bsed_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyya
dsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvtv
ss

SCOPe Domain Coordinates for d2bsed_:

Click to download the PDB-style file with coordinates for d2bsed_.
(The format of our PDB-style files is described here.)

Timeline for d2bsed_: