Lineage for d2bphb1 (2bph B:117-244)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002670Species Mouse (Mus musculus) [TaxId:10090] [187331] (26 PDB entries)
  8. 3002707Domain d2bphb1: 2bph B:117-244 [163143]
    Other proteins in same PDB: d2bpha2, d2bphb2
    automated match to d1ypqa1
    complexed with mg

Details for d2bphb1

PDB Entry: 2bph (more details), 2.2 Å

PDB Description: structure of murine dectin-1
PDB Compounds: (B:) dectin-1

SCOPe Domain Sequences for d2bphb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bphb1 d.169.1.0 (B:117-244) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqtsshrin
afwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqicntss
ysicekel

SCOPe Domain Coordinates for d2bphb1:

Click to download the PDB-style file with coordinates for d2bphb1.
(The format of our PDB-style files is described here.)

Timeline for d2bphb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bphb2