Lineage for d2bpea1 (2bpe A:117-244)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2235412Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2235413Protein automated matches [190159] (16 species)
    not a true protein
  7. 2235708Species Mouse (Mus musculus) [TaxId:10090] [187331] (21 PDB entries)
  8. 2235731Domain d2bpea1: 2bpe A:117-244 [163140]
    Other proteins in same PDB: d2bpea2, d2bpeb2
    automated match to d1ypqa1
    complexed with ca, cl, pg4

Details for d2bpea1

PDB Entry: 2bpe (more details), 2.25 Å

PDB Description: structure of murine dectin-1
PDB Compounds: (A:) dectin-1

SCOPe Domain Sequences for d2bpea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bpea1 d.169.1.0 (A:117-244) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqtsshrin
afwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqicntss
ysicekel

SCOPe Domain Coordinates for d2bpea1:

Click to download the PDB-style file with coordinates for d2bpea1.
(The format of our PDB-style files is described here.)

Timeline for d2bpea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bpea2