Lineage for d2bpea_ (2bpe A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1443240Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1443241Protein automated matches [190159] (8 species)
    not a true protein
  7. 1443457Species Mouse (Mus musculus) [TaxId:10090] [187331] (13 PDB entries)
  8. 1443476Domain d2bpea_: 2bpe A: [163140]
    automated match to d1ypqa1
    complexed with ca, cl, pg4

Details for d2bpea_

PDB Entry: 2bpe (more details), 2.25 Å

PDB Description: structure of murine dectin-1
PDB Compounds: (A:) dectin-1

SCOPe Domain Sequences for d2bpea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bpea_ d.169.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqtsshrin
afwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqicntss
ysicekelk

SCOPe Domain Coordinates for d2bpea_:

Click to download the PDB-style file with coordinates for d2bpea_.
(The format of our PDB-style files is described here.)

Timeline for d2bpea_: