Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (16 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187331] (21 PDB entries) |
Domain d2bpdb_: 2bpd B: [163139] automated match to d1ypqa1 |
PDB Entry: 2bpd (more details), 1.5 Å
SCOPe Domain Sequences for d2bpdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bpdb_ d.169.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} sqsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqtsshri nafwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqicnts sysicekel
Timeline for d2bpdb_: