Lineage for d2bpdb_ (2bpd B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2235412Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2235413Protein automated matches [190159] (16 species)
    not a true protein
  7. 2235708Species Mouse (Mus musculus) [TaxId:10090] [187331] (21 PDB entries)
  8. 2235710Domain d2bpdb_: 2bpd B: [163139]
    automated match to d1ypqa1

Details for d2bpdb_

PDB Entry: 2bpd (more details), 1.5 Å

PDB Description: structure of murine dectin-1
PDB Compounds: (B:) dectin-1

SCOPe Domain Sequences for d2bpdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bpdb_ d.169.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sqsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqtsshri
nafwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqicnts
sysicekel

SCOPe Domain Coordinates for d2bpdb_:

Click to download the PDB-style file with coordinates for d2bpdb_.
(The format of our PDB-style files is described here.)

Timeline for d2bpdb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bpda_