SCOPe 2.06: Domain d2bmma_: 2bmm A:

Lineage for d2bmma_ (2bmm A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
   lack the first helix (A)

6. Protein automated matches [190322] (4 species)
   not a true protein

7. Species Thermobifida fusca [TaxId:2021] [187474] (1 PDB entry)

8. Domain d2bmma_: 2bmm A: [163124]
   automated match to d1ngka_
   complexed with act, hem

Details for d2bmma_

PDB Entry: 2bmm, 2.48 Å

PDB Description: x-ray structure of a novel thermostable hemoglobin from the actinobacterium thermobifida fusca

PDB Compounds: (A:) thermostable hemoglobin from thermobifida fusca

SCOPe Domain Sequences for d2bmma_:

Sequence; same for both SEQRES and ATOM records:

>d2bmma_ a.1.1.1 (A:) automated matches {Thermobifida fusca [TaxId: 2021]}
mtfyeavggeetftrlarrfyegvaadpvlrpmypeedlgpaeerlrlflmqywggprty
serrghprlrmrhfpyrigaeerdrwlthmraavddlalpahleqqlweylvyaayamvn
vpe

Timeline for d2bmma_:

• d2bmma_ first appeared in SCOPe 2.01
  
• d2bmma_ appears in SCOPe 2.05
  
• d2bmma_ appears in SCOPe 2.07
  
• d2bmma_ appears in the current release, SCOPe 2.08