SCOPe 2.08: Domain d2bl9a_: 2bl9 A:

Lineage for d2bl9a_ (2bl9 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein automated matches [190514] (12 species)
   not a true protein

7. Species Plasmodium vivax [TaxId:5855] [187469] (4 PDB entries)

8. Domain d2bl9a_: 2bl9 A: [163121]
   automated match to d1j3ia_
   complexed with cp6, ndp

Details for d2bl9a_

PDB Entry: 2bl9, 1.9 Å

PDB Description: x-ray crystal structure of plasmodium vivax dihydrofolate reductase in complex with pyrimethamine and its derivative

PDB Compounds: (A:) dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d2bl9a_:

Sequence, based on SEQRES records:

>d2bl9a_ c.71.1.1 (A:) automated matches {Plasmodium vivax [TaxId: 5855]}
enlsdvfdiyaicacckvaptsagtknepfsprtfrglgnkgtlpwkcnsvdmkyfssvt
tyvdeskyeklkwkrerylrmeasqgggdntsggdnthggdnadklqnvvvmgrsswesi
pkqykplpnrinvvlsktltkedvkekvfiidsiddlllllkklkyykcfiiggaqvyre
clsrnlikqiyftringaypcdvffpefdesefrvtsvsevynskgttldflvyskv

Sequence, based on observed residues (ATOM records):

>d2bl9a_ c.71.1.1 (A:) automated matches {Plasmodium vivax [TaxId: 5855]}
enlsdvfdiyaicacckvaptsagtknepfsprtfrglgnkgtlpwkcnsvdmkyfssvt
tyvdeskyeklkwkrerylrmeaklqnvvvmgrsswesipkqykplpnrinvvlsktltk
edvkekvfiidsiddlllllkklkyykcfiiggaqvyreclsrnlikqiyftringaypc
dvffpefdesefrvtsvsevynskgttldflvyskv

Timeline for d2bl9a_:

• d2bl9a_ first appeared in SCOPe 2.01
  
• d2bl9a_ appears in SCOPe 2.07