SCOPe 2.06: Domain d2bjoa_: 2bjo A:

Lineage for d2bjoa_ (2bjo A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.227: OsmC-like [82783] (1 superfamily)
   swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix

4. Superfamily d.227.1: OsmC-like [82784] (3 families)

5. Family d.227.1.0: automated matches [191395] (1 protein)
   not a true family

6. Protein automated matches [190512] (3 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187466] (1 PDB entry)

8. Domain d2bjoa_: 2bjo A: [163110]
   automated match to d1uspa_

Details for d2bjoa_

PDB Entry: 2bjo, 2.1 Å

PDB Description: crystal structure of the organic hydroperoxide resistance protein ohrb of bacillus subtilis

PDB Compounds: (A:) organic hydroperoxide resistance protein ohrb

SCOPe Domain Sequences for d2bjoa_:

Sequence; same for both SEQRES and ATOM records:

>d2bjoa_ d.227.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
alftakvtarggraghitsddgvldfdivmpnaaaagqtgtnpeqlfaagyaacfggale
hvakeqnieidseiegqvslmkdesdggfkigvtlvvntkdldrekaqelvnaahefcpy
skatrgnvdvklelk

Timeline for d2bjoa_:

• d2bjoa_ first appeared in SCOPe 2.01
  
• d2bjoa_ appears in SCOPe 2.05
  
• d2bjoa_ appears in SCOPe 2.07
  
• d2bjoa_ appears in the current release, SCOPe 2.08