Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.227: OsmC-like [82783] (1 superfamily) swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix |
Superfamily d.227.1: OsmC-like [82784] (3 families) |
Family d.227.1.0: automated matches [191395] (1 protein) not a true family |
Protein automated matches [190512] (3 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [187466] (1 PDB entry) |
Domain d2bjoa_: 2bjo A: [163110] automated match to d1uspa_ |
PDB Entry: 2bjo (more details), 2.1 Å
SCOPe Domain Sequences for d2bjoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bjoa_ d.227.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} alftakvtarggraghitsddgvldfdivmpnaaaagqtgtnpeqlfaagyaacfggale hvakeqnieidseiegqvslmkdesdggfkigvtlvvntkdldrekaqelvnaahefcpy skatrgnvdvklelk
Timeline for d2bjoa_: