Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (10 species) not a true protein |
Species Clostridium perfringens [TaxId:1502] [188628] (5 PDB entries) |
Domain d2bjfa_: 2bjf A: [163100] automated match to d3pvaa_ complexed with dxc, gol, tau |
PDB Entry: 2bjf (more details), 1.67 Å
SCOPe Domain Sequences for d2bjfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bjfa_ d.153.1.0 (A:) automated matches {Clostridium perfringens [TaxId: 1502]} ctglaletkdglhlfgrnmdieysfnqsiifiprnfkcvnksnkkelttkyavlgmgtif ddyptfadgmnekglgcaglnfpvyvsyskediegktnipvynfllwvlanfssveevke alknanivdipisenipnttlhwmisditgksivveqtkeklnvfdnnigvltnsptfdw hvanlnqyvglrynqvpefklgdqsltalgqgtglvglpgdftpasrfirvaflrdamik ndkdsidlieffhilnnvamvrgstrtveeksdltqytscmclekgiyyyntyennqina idmnkenldgneiktykynktlsinhvn
Timeline for d2bjfa_: