Lineage for d2bjfa_ (2bjf A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. Protein automated matches [190509] (19 species)
    not a true protein
  7. Species Clostridium perfringens [TaxId:1502] [188628] (5 PDB entries)
  8. Domain d2bjfa_: 2bjf A: [163100]
    automated match to d3pvaa_
    complexed with dxc, gol, tau

Details for d2bjfa_

PDB Entry: 2bjf (more details), 1.67 Å

PDB Description: crystal structure of conjugated bile acid hydrolase from clostridium perfringens in complex with reaction products taurine and deoxycholate
PDB Compounds: (A:) choloylglycine hydrolase

SCOPe Domain Sequences for d2bjfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bjfa_ d.153.1.0 (A:) automated matches {Clostridium perfringens [TaxId: 1502]}
ctglaletkdglhlfgrnmdieysfnqsiifiprnfkcvnksnkkelttkyavlgmgtif
ddyptfadgmnekglgcaglnfpvyvsyskediegktnipvynfllwvlanfssveevke
alknanivdipisenipnttlhwmisditgksivveqtkeklnvfdnnigvltnsptfdw
hvanlnqyvglrynqvpefklgdqsltalgqgtglvglpgdftpasrfirvaflrdamik
ndkdsidlieffhilnnvamvrgstrtveeksdltqytscmclekgiyyyntyennqina
idmnkenldgneiktykynktlsinhvn

SCOPe Domain Coordinates for d2bjfa_ are not available.

Timeline for d2bjfa_: