| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) ![]() duplication: contains two structural repeats |
| Family f.43.1.1: Chlorophyll a-b binding protein [103512] (2 proteins) |
| Protein automated matches [190507] (3 species) not a true protein |
| Species Pea (Pisum sativum) [TaxId:3888] [187461] (2 PDB entries) |
| Domain d2bhwb_: 2bhw B: [163090] automated match to d1rwtf_ complexed with chl, cla, dgd, lhg, lux, nex, xat |
PDB Entry: 2bhw (more details), 2.5 Å
SCOPe Domain Sequences for d2bhwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bhwb_ f.43.1.1 (B:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
assgspwygpdrvkylgpfsgespsyltgefpgdygwdtaglsadpetfsknrelevihs
rwamlgalgsvfpellsrngvkfgeavwfkagsqifseggldylgnpslvhaqsilaiwa
tqvilmgavegyriaggplgevvdplypggsfdplgladdpeafaelkvkelkngrlamf
smfgffvqaivtgkgplenladhladpvnnnawsyatnfvpgk
Timeline for d2bhwb_: