Lineage for d2bhwb_ (2bhw B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028373Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 3028374Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 3028375Family f.43.1.1: Chlorophyll a-b binding protein [103512] (2 proteins)
  6. 3028388Protein automated matches [190507] (3 species)
    not a true protein
  7. 3028408Species Pea (Pisum sativum) [TaxId:3888] [187461] (2 PDB entries)
  8. 3028419Domain d2bhwb_: 2bhw B: [163090]
    automated match to d1rwtf_
    complexed with chl, cla, dgd, lhg, lux, nex, xat

Details for d2bhwb_

PDB Entry: 2bhw (more details), 2.5 Å

PDB Description: pea light-harvesting complex ii at 2.5 angstrom resolution
PDB Compounds: (B:) chlorophyll a-b binding protein ab80

SCOPe Domain Sequences for d2bhwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bhwb_ f.43.1.1 (B:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
assgspwygpdrvkylgpfsgespsyltgefpgdygwdtaglsadpetfsknrelevihs
rwamlgalgsvfpellsrngvkfgeavwfkagsqifseggldylgnpslvhaqsilaiwa
tqvilmgavegyriaggplgevvdplypggsfdplgladdpeafaelkvkelkngrlamf
smfgffvqaivtgkgplenladhladpvnnnawsyatnfvpgk

SCOPe Domain Coordinates for d2bhwb_:

Click to download the PDB-style file with coordinates for d2bhwb_.
(The format of our PDB-style files is described here.)

Timeline for d2bhwb_: