Lineage for d2bhwa_ (2bhw A:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1458438Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 1458439Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (1 family) (S)
    duplication: contains two structural repeats
  5. 1458440Family f.43.1.1: Chlorophyll a-b binding protein [103512] (2 proteins)
  6. 1458453Protein automated matches [190507] (1 species)
    not a true protein
  7. 1458454Species Pea (Pisum sativum) [TaxId:3888] [187461] (1 PDB entry)
  8. 1458455Domain d2bhwa_: 2bhw A: [163089]
    automated match to d1rwtf_
    complexed with chl, cla, dgd, lhg, lux, nex, xat

Details for d2bhwa_

PDB Entry: 2bhw (more details), 2.5 Å

PDB Description: pea light-harvesting complex ii at 2.5 angstrom resolution
PDB Compounds: (A:) chlorophyll a-b binding protein ab80

SCOPe Domain Sequences for d2bhwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bhwa_ f.43.1.1 (A:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
assgspwygpdrvkylgpfsgespsyltgefpgdygwdtaglsadpetfsknrelevihs
rwamlgalgsvfpellsrngvkfgeavwfkagsqifseggldylgnpslvhaqsilaiwa
tqvilmgavegyriaggplgevvdplypggsfdplgladdpeafaelkvkelkngrlamf
smfgffvqaivtgkgplenladhladpvnnnawsyatnfvpgk

SCOPe Domain Coordinates for d2bhwa_:

Click to download the PDB-style file with coordinates for d2bhwa_.
(The format of our PDB-style files is described here.)

Timeline for d2bhwa_: