SCOPe 2.06: Domain d2bh4x_: 2bh4 X:

Lineage for d2bh4x_ (2bh4 X:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein automated matches [190113] (17 species)
   not a true protein

7. Species Paracoccus versutus [TaxId:34007] [187457] (3 PDB entries)

8. Domain d2bh4x_: 2bh4 X: [163082]
   automated match to d1cota_
   complexed with hec

Details for d2bh4x_

PDB Entry: 2bh4, 1.55 Å

PDB Description: x-ray structure of the m100k variant of ferric cyt c-550 from paracoccus versutus determined at 100 k.

PDB Compounds: (X:) cytochrome c-550

SCOPe Domain Sequences for d2bh4x_:

Sequence; same for both SEQRES and ATOM records:

>d2bh4x_ a.3.1.1 (X:) automated matches {Paracoccus versutus [TaxId: 34007]}
egdaakgekefnkckachmvqapdgtdivkggktgpnlygvvgrkiasvegfkygdgile
vaeknpdmvwseadlieyvtdpkpwlvektgdsaaktkktfklgknqadvvaflaqhspd
ag

Timeline for d2bh4x_:

• d2bh4x_ first appeared in SCOPe 2.01
  
• d2bh4x_ appears in SCOPe 2.05
  
• d2bh4x_ appears in SCOPe 2.07
  
• d2bh4x_ appears in the current release, SCOPe 2.08