Lineage for d2bg8b_ (2bg8 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996833Protein automated matches [190079] (12 species)
    not a true protein
  7. 2996836Species Bacillus cereus [TaxId:1396] [187455] (15 PDB entries)
  8. 2996856Domain d2bg8b_: 2bg8 B: [163078]
    automated match to d1bc2a_
    complexed with gol, so4, zn; mutant

Details for d2bg8b_

PDB Entry: 2bg8 (more details), 2.5 Å

PDB Description: bacillus cereus metallo-beta-lactamase (bcii) arg (121) cys mutant. solved at ph4.5 using 20 micromolar znso4 in the buffer. 1mm dtt and 1mm tcep-hcl were used as reducing agents.
PDB Compounds: (B:) beta-lactamase II

SCOPe Domain Sequences for d2bg8b_:

Sequence, based on SEQRES records: (download)

>d2bg8b_ d.157.1.1 (B:) automated matches {Bacillus cereus [TaxId: 1396]}
ktviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltk
eliemvekkfqkrvtdviithahadciggiktlkergikahstaltaelakkngyeeplg
dlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvaday
vnewstsienvlkryrninavvpghgevgdkglllhtldllk

Sequence, based on observed residues (ATOM records): (download)

>d2bg8b_ d.157.1.1 (B:) automated matches {Bacillus cereus [TaxId: 1396]}
ktviknetgtisisqlnknvwvhtelgseavpsnglvlntskglvlvdsswddkltkeli
emvekkfqkrvtdviithahadciggiktlkergikahstaltaelakkngyeeplgdlq
tvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayvne
wstsienvlkryrninavvpghgevgdkglllhtldllk

SCOPe Domain Coordinates for d2bg8b_:

Click to download the PDB-style file with coordinates for d2bg8b_.
(The format of our PDB-style files is described here.)

Timeline for d2bg8b_: