Class a: All alpha proteins [46456] (284 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
Protein automated matches [190501] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187448] (11 PDB entries) |
Domain d2b91a_: 2b91 A: [163012] automated match to d1itla_ complexed with so4 |
PDB Entry: 2b91 (more details), 2 Å
SCOPe Domain Sequences for d2b91a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b91a_ a.26.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hkcditlqeiiktlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhe kdtrclgataqqfhrhkqlirdlkaldrnlwglaglnscpvkeanqstlenflerlktim rekyskcss
Timeline for d2b91a_: