SCOP 1.65: Domain d1pysb2: 1pys B:400-474

Lineage for d1pysb2 (1pys B:400-474)

Root: SCOP 1.65
Class a: All alpha proteins [46456] (179 folds)
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
Superfamily a.6.1: Putative DNA-binding domain [46955] (7 families)
Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
dulication: contains two such domains related by pseudo dyad
Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)
Species Thermus thermophilus (Thermus aquaticus) [46958] (5 PDB entries)
Domain d1pysb2: 1pys B:400-474 [16300]
Other proteins in same PDB: d1pysa_, d1pysb3, d1pysb4, d1pysb5, d1pysb6
complexed with mg

Details for d1pysb2

PDB Entry: 1pys (more details), 2.9 Å

PDB Description: phenylalanyl-trna synthetase from thermus thermophilus

SCOP Domain Sequences for d1pysb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pysb2 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl
veevariqgyetipl

SCOP Domain Coordinates for d1pysb2:

Click to download the PDB-style file with coordinates for d1pysb2.
(The format of our PDB-style files is described here.)

Timeline for d1pysb2: