SCOP 1.61: Domain d1pysb2: 1pys B:400-474

Lineage for d1pysb2 (1pys B:400-474)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (5 families)

5. Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)

6. Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)

7. Species Thermus thermophilus (Thermus aquaticus) [46958] (5 PDB entries)

8. Domain d1pysb2: 1pys B:400-474 [16300]
   Other proteins in same PDB: d1pysa_, d1pysb3, d1pysb4, d1pysb5, d1pysb6

Details for d1pysb2

PDB Entry: 1pys, 2.9 Å

PDB Description: phenylalanyl-trna synthetase from thermus thermophilus

SCOP Domain Sequences for d1pysb2:

Sequence; same for both SEQRES and ATOM records:

>d1pysb2 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl
veevariqgyetipl

Timeline for d1pysb2:

• d1pysb2 first appeared (with stable ids) in SCOP 1.55
  
• d1pysb2 appears in SCOP 1.59
  
• d1pysb2 appears in SCOP 1.63
  
• d1pysb2 appears in the current release, SCOPe 2.08