Class a: All alpha proteins [46456] (171 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) |
Protein Ribosomal protein S13 [46948] (1 species) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension |
Species Thermus thermophilus [TaxId:274] [46949] (14 PDB entries) |
Domain d1hnxm_: 1hnx M: [16297] Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_ complexed with mg, pcy, zn |
PDB Entry: 1hnx (more details), 3.4 Å
SCOP Domain Sequences for d1hnxm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnxm_ a.156.1.1 (M:) Ribosomal protein S13 {Thermus thermophilus} ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk kaprk
Timeline for d1hnxm_: